PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03407.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 299aa    MW: 33883.3 Da    PI: 6.1876
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03407.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.87.3e-11182225548
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                              kr +r   NR +A+rsR RK+++i eLe+ v +L++e + L  +
  Rsa1.0_03407.1_g00003.1 182 KRVKRILANRQSAQRSRVRKLQYISELERSVTTLQSEVSVLSPR 225
                              8999********************************98777655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.7E-13178242IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.634180232IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.93E-11182236No hitNo description
Gene3DG3DSA:1.20.5.1703.0E-13182233No hitNo description
PfamPF001702.6E-9182225IPR004827Basic-leucine zipper domain
CDDcd147031.37E-24183233No hitNo description
PROSITE patternPS000360185200IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MAQLPPKIPN MTPPHWPNFS SQKLPHFSTA AASSAVQNPS WVDEFLDFSA CRRGNHRRSI  60
SDSIAFLEAP IVTSHMEEHN FDKFDDEQFM SMFTDDDDDL CNHPSHNNKN VGPNDSSLNT  120
STGADHKSFN DDKEPPSHHN MNVNYNNCNE EVTGQCKTEP EDGTESSNNS GDSSGNRIID  180
PKRVKRILAN RQSAQRSRVR KLQYISELER SVTTLQSEVS VLSPRVAFLD HQRLLLNVDN  240
SALKQRIAAL AQDKIFKDAH QESLKREIER LRQVYQQQSF EKMENANHSP ETGVDIKAL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2411040.0AC241104.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH017L09, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013683759.10.0PREDICTED: basic leucine zipper 34-like
SwissprotF4IN231e-143BZP34_ARATH; Basic leucine zipper 34
TrEMBLV4M9C21e-154V4M9C2_EUTSA; Uncharacterized protein
STRINGBra000256.1-P1e-151(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17532777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.21e-135bZIP family protein